Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.900 7.1e-09
astrocytic glioma -2.300 5.9e-04
Astrocytoma, Pilocytic -1.800 1.7e-11
atypical teratoid / rhabdoid tumor -2.000 1.7e-05
breast carcinoma -1.600 4.4e-05
cystic fibrosis 1.073 5.8e-04
ductal carcinoma in situ -1.100 3.5e-04
ependymoma -2.500 1.3e-03
fibroadenoma -1.600 2.0e-02
glioblastoma -2.600 3.0e-08
group 3 medulloblastoma -1.500 7.5e-04
interstitial cystitis -1.800 3.9e-04
intraductal papillary-mucinous adenoma (... 1.400 1.2e-04
intraductal papillary-mucinous carcinoma... 1.200 6.5e-04
intraductal papillary-mucinous neoplasm ... 1.900 2.4e-04
invasive ductal carcinoma -1.200 1.0e-03
lung adenocarcinoma -1.900 6.1e-09
lung cancer -1.300 1.9e-03
medulloblastoma, large-cell -2.400 7.7e-04
nasopharyngeal carcinoma -1.300 3.3e-05
oligodendroglioma -1.700 4.7e-03
ovarian cancer -1.400 3.1e-05
primitive neuroectodermal tumor -1.800 9.0e-03
subependymal giant cell astrocytoma -3.482 1.1e-02
urothelial carcinoma -1.400 2.8e-02

AA Sequence

MSTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQMSQEFLQQSL      1 - 70
KEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQVVSQFHRLLQQCGPQCEGHQ     71 - 140
LFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPSTNSFEKEKQDYVYCLESSLQTYNPDYVLMV    141 - 210
EDDAVPEEQIFPVLEHLLRARFSEPHLRDALYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPLLTWIY    211 - 280
MRFASRPGFSWPVMLFFSLYSMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTY    281 - 350
LSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL                     351 - 403
//

Text Mined References (6)

PMID Year Title