Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.400 2.8e-02
astrocytic glioma -2.300 5.9e-04
ependymoma -2.800 1.1e-17
oligodendroglioma -1.700 4.7e-03
glioblastoma -2.700 2.7e-05
sonic hedgehog group medulloblastoma -1.600 9.8e-04
cystic fibrosis 1.320 1.5e-04
atypical teratoid / rhabdoid tumor -2.000 1.7e-05
medulloblastoma, large-cell -2.400 7.7e-04
primitive neuroectodermal tumor -1.800 9.0e-03
intraductal papillary-mucinous adenoma (... 1.400 1.2e-04
intraductal papillary-mucinous carcinoma... 1.200 6.5e-04
intraductal papillary-mucinous neoplasm ... 1.900 2.4e-04
lung cancer -1.300 1.9e-03
breast carcinoma -1.600 4.4e-05
fibroadenoma -1.600 2.0e-02
interstitial cystitis -1.900 2.3e-05
adult high grade glioma -2.900 7.1e-09
pilocytic astrocytoma -1.800 1.7e-11
subependymal giant cell astrocytoma -3.482 1.1e-02
lung adenocarcinoma -1.900 6.1e-09
nasopharyngeal carcinoma -1.300 3.3e-05
ductal carcinoma in situ -1.200 6.6e-04
invasive ductal carcinoma -1.300 2.3e-03
ovarian cancer -1.400 3.1e-05

Synonym

Accession Q9BRR3 Q49AQ4
Symbols C9orf125

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQMSQEFLQQSL      1 - 70
KEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQVVSQFHRLLQQCGPQCEGHQ     71 - 140
LFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPSTNSFEKEKQDYVYCLESSLQTYNPDYVLMV    141 - 210
EDDAVPEEQIFPVLEHLLRARFSEPHLRDALYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPLLTWIY    211 - 280
MRFASRPGFSWPVMLFFSLYSMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTY    281 - 350
LSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL                     351 - 403
//

Text Mined References (6)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.