Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.32
PubTator Score 1.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.5e-03
glioblastoma 1.200 5.0e-03
group 4 medulloblastoma -1.200 9.6e-03
lung cancer -2.600 4.6e-06
lung carcinoma -2.800 2.1e-33
Multiple myeloma 1.550 3.7e-04
non-small cell lung cancer -1.639 4.7e-25
ovarian cancer -1.400 1.6e-03

Gene RIF (2)

AA Sequence

MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISL      1 - 70
SSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR                           71 - 118
//

Text Mined References (11)

PMID Year Title