Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.9e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.226 2.9e-05

AA Sequence

MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLL      1 - 70
YYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITSSVPWTAELQLHG     71 - 140
KGQLQTLSQKCKREASGTQSERFG                                                  141 - 164
//

Text Mined References (8)

PMID Year Title