Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 2.8e-05
ependymoma -1.500 8.3e-10
group 3 medulloblastoma -1.300 2.3e-04
lung carcinoma 1.100 1.8e-11
medulloblastoma, large-cell -1.500 4.0e-05
ovarian cancer 1.100 1.6e-09

Synonym

Accession Q8NBD8
Symbols C14orf83

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIVERMYLRLRGR      1 - 70
CPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIRNTL     71 - 140
RLRFDKDAEPGEPSGALALANGHVKTD                                               141 - 167
//

Text Mined References (6)

PMID Year Title