Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.99
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Azoospermia 110 3.663 1.8

AA Sequence

MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMM      1 - 70
TSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWI     71 - 140
MYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVN    141 - 210
SLNKKVQTRHVTWAL                                                           211 - 225
//

Text Mined References (3)

PMID Year Title