Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.06
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 8.4e-17
glioblastoma 1.500 2.8e-12
group 3 medulloblastoma 1.700 2.8e-05
atypical teratoid/rhabdoid tumor 1.600 4.3e-11
medulloblastoma, large-cell 1.300 1.2e-03
primitive neuroectodermal tumor 1.600 4.7e-06
tuberculosis 1.400 4.1e-04
pediatric high grade glioma 1.300 1.3e-06
pilocytic astrocytoma 1.200 3.1e-07
ovarian cancer 1.400 3.2e-04

Synonym

Accession A2RU14 B7ZM48
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEV      1 - 70
KIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY                              71 - 115
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.