Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.42
PubTator Score 3.62

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.200 1.4e-03
ovarian cancer 1.600 6.6e-06
pancreatic ductal adenocarcinoma liver m... -1.430 4.7e-03
urothelial carcinoma -1.100 4.7e-02

Gene RIF (2)

AA Sequence

MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHISMGCAFINLC      1 - 70
ILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPY     71 - 140
RQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL                         141 - 189
//

Text Mined References (12)

PMID Year Title