Property Summary

NCBI Gene PubMed Count 5
PubMed Score 113.75
PubTator Score 3.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.2e-10
medulloblastoma, large-cell 6234 1.6e-06
Disease Target Count Z-score Confidence
Crohn's disease 304 5.494 2.7
Colitis 46 3.759 1.9
Amyloidosis 68 3.512 1.8


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.808 1.2e-10
medulloblastoma, large-cell 1.400 1.6e-06

Gene RIF (2)

24950247 the nucleoplasmic domains of Samp1 and Emerin can bind directly to each other.
19494128 characterization of a transmembrane protein of the nuclear envelope that we name spindle-associated membrane protein 1 (Samp1); Samp1 defines a specific membrane domain associated with the mitotic spindle

AA Sequence

ATWRGRFGPSLVRGLLAVSLAANALFTSVFLYQSLR                                      631 - 666

Text Mined References (12)

PMID Year Title
24950247 2014 MCLIP, an effective method to detect interactions of transmembrane proteins of the nuclear envelope in live cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21327071 A transmembrane inner nuclear membrane protein in the mitotic spindle.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19494128 2009 An integral protein of the inner nuclear membrane localizes to the mitotic spindle in mammalian cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.