Property Summary

NCBI Gene PubMed Count 2
PubMed Score 7.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.5e-11
cystic fibrosis 1696 1.7e-04
ductal carcinoma in situ 1745 4.8e-04
osteosarcoma 7950 1.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.300 1.7e-04
ductal carcinoma in situ -1.700 4.8e-04
osteosarcoma -3.393 1.2e-03
ovarian cancer -1.800 1.5e-11

AA Sequence

MTAGSPEECGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIA      1 - 70
VAGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVIMGVGLFVFICANTLLYENR     71 - 140
DLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRSPRAVGCAEPEIWDPSPRRGTSPVPSVRSLRSEP    141 - 210
ANPRLGLPALLNSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAH    211 - 280
RSWPRLDRLSLGGYAKLGGGGDLGARV                                               281 - 307
//

Text Mined References (4)

PMID Year Title