Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 4.5e-07
osteosarcoma 7933 1.2e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.138 1.2e-06
atypical teratoid/rhabdoid tumor -1.300 4.5e-07

Gene RIF (1)

PMID Text
21536646 these results identified TMEM198 as a membrane scaffold protein that promotes LRP6 phosphorylation and Wnt signaling activation.

AA Sequence

MPGTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCFKAVLFLTGLL      1 - 70
FGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFLVGLLLGLLLAAAALLGSAPY     71 - 140
YQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTGAALIATAADYFAELLLLGRYVVERLRAAPV    141 - 210
PPLCWRSWALLALWPLLSLMGVLVQWRVTAEGDSHTEVVISRQRRRVQLMRIRQQEDRKEKRRKKRPPRA    211 - 280
PLRGPRAPPRPGPPDPAYRRRPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDADYEYGSRGPL    281 - 350
TACSGPPVRV                                                                351 - 360
//

Text Mined References (4)

PMID Year Title
21536646 2011 Transmembrane protein 198 promotes LRP6 phosphorylation and Wnt signaling activation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.