Property Summary

NCBI Gene PubMed Count 13
PubMed Score 155.84
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.700 9.0e-04
group 4 medulloblastoma -1.400 3.2e-04

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW      1 - 70
EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC     71 - 140
LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP    141 - 210
RKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK              211 - 270
//

Text Mined References (17)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11280764 2001 Molecular basis of T cell-mediated recognition of pancreatic cancer cells.
11076860 2000 Fusion of the human gene for the polyubiquitination coeffector UEV1 with Kua, a newly identified gene.
11076848 2000 A new function evolved from gene fusion.
11057907 2000 Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain.
10089880 1999 Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair.
9771976 1998 Up-regulation of CIR1/CROC1 expression upon cell immortalization and in tumor-derived human cell lines.
9705497 1998 The products of the yeast MMS2 and two human homologs (hMMS2 and CROC-1) define a structurally and functionally conserved Ubc-like protein family.
9418904 1998 Role of UEV-1, an inactive variant of the E2 ubiquitin-conjugating enzymes, in in vitro differentiation and cell cycle behavior of HT-29-M6 intestinal mucosecretory cells.
9305758 1997 CROC-1 encodes a protein which mediates transcriptional activation of the human FOS promoter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.