Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.50
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.100 5.4e-03
cystic fibrosis 1.189 1.3e-05
osteosarcoma -1.730 1.2e-03
ovarian cancer 1.100 2.2e-05
posterior fossa group B ependymoma 1.100 4.4e-07

Gene RIF (1)

AA Sequence

MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLS      1 - 70
WLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPW     71 - 140
LFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLC    141 - 210
DHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR                       211 - 261
//

Text Mined References (8)

PMID Year Title