Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 4.2e-06
osteosarcoma 7950 1.2e-05
lung cancer 4740 1.2e-02
acute myeloid leukemia 783 2.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.200 2.4e-02
lung cancer 1.100 1.2e-02
malignant mesothelioma 1.100 4.2e-06
osteosarcoma -1.255 1.2e-05

Synonym

Accession Q96B77 B2RAY0 Q9Y4T4
Symbols C16orf51

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAALLRAVRRFRGKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFYRFDAIRTFGF      1 - 70
LSRLKLAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISGFALTMLCWMSYFLRRLVGILYLNESGTML     71 - 140
RVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQ    141 - 210
MLK                                                                       211 - 213
//

Text Mined References (7)

PMID Year Title