Property Summary

NCBI Gene PubMed Count 15
PubMed Score 28.24
PubTator Score 32.15

Knowledge Summary

Patent

No data available

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVGTGVWARNPQ      1 - 70
YRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSL     71 - 140
ELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTH    141 - 210
ITMALSWMTIVVPLLTFEILLVHKLDGHNAFSSIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQ    211 - 280
FLLEIFPFLREYGNISYDLHHEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD    281 - 350
//

Text Mined References (16)

PMID Year Title