Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.81
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acrocallosal syndrome 12 4.194 2.1
Hypertrichosis 46 3.898 1.9
spina bifida 1074 3.176 1.6

Expression

Gene RIF (1)

AA Sequence

MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQH      1 - 70
LVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNL     71 - 140
VLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAW    141 - 210
TYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTW    211 - 280
EWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHV    281 - 350
GRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEI    351 - 420
LSDTIGEKKEPSDKSVDS                                                        421 - 438
//

Text Mined References (9)

PMID Year Title