Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.44
PubTator Score 1.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 4.5e-05
glioblastoma -1.100 3.5e-05
group 4 medulloblastoma -1.300 1.3e-05
medulloblastoma, large-cell -1.800 5.3e-05
ovarian cancer 2.000 2.3e-07
pancreatic ductal adenocarcinoma liver m... 1.621 1.5e-03

Protein-protein Interaction (8)

Gene RIF (2)

AA Sequence

MTVRGDVLAPDPASPTTAAASPSVSVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLITCHQIYMHLR      1 - 70
CYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSI     71 - 140
MSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSG    141 - 210
YLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHS    211 - 280
ARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIV    281 - 350
QDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF                 351 - 407
//

Text Mined References (16)

PMID Year Title