Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.16
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 4.6e-12
Breast cancer 3098 2.0e-05
ovarian cancer 8491 1.4e-04
fibroadenoma 557 1.6e-03
interstitial cystitis 2299 4.3e-03

Expression

  Differential Expression (5)

Disease log2 FC p
fibroadenoma 1.200 1.6e-03
interstitial cystitis -1.200 4.3e-03
lung adenocarcinoma 2.500 4.6e-12
Breast cancer 1.100 2.0e-05
ovarian cancer -1.200 1.4e-04

 GO Process (1)

Gene RIF (1)

PMID Text
26769965 TMEM184A functions as a heparin receptor and mediates anti-inflammatory responses of endothelial cells involving decreased JNK and p38 activity.

AA Sequence

MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSGIFVWTALVLT      1 - 70
CHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCF     71 - 140
QYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYH    141 - 210
DGDFNVRSGYLYVTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILER    211 - 280
CGVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGI    281 - 350
RETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL           351 - 413
//

Text Mined References (9)

PMID Year Title
26769966 2016 Transmembrane Protein 184A Is a Receptor Required for Vascular Smooth Muscle Cell Responses to Heparin.
26769965 2016 Heparin Decreases in Tumor Necrosis Factor ? (TNF?)-induced Endothelial Stress Responses Require Transmembrane Protein 184A and Induction of Dual Specificity Phosphatase 1.
18321981 2008 Sdmg1 is a conserved transmembrane protein associated with germ cell sex determination and germline-soma interactions in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.