Property Summary

NCBI Gene PubMed Count 53
PubMed Score 24.50
PubTator Score 29.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
Breast cancer 3098 3.3e-20
osteosarcoma 7933 6.2e-06
sonic hedgehog group medulloblastoma 1482 8.7e-06
ovarian cancer 8491 3.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.486 6.2e-06
sonic hedgehog group medulloblastoma 1.100 8.7e-06
Breast cancer -1.100 3.3e-20
ovarian cancer -1.500 3.8e-04

Gene RIF (40)

PMID Text
26365393 Studies indicate association of transmembrane protein 18 (TMEM18) variants within the proximal haplotype block with obesity and body mass.
25640768 Genetic variants associated with BMI and WHR in adults influence growth patterns and general and abdominal fat development from early childhood onwards.
25189249 FTO-rs9939609, TMEM18-rs6548238 and PCSK1-rs6234 polymorphisms are significantly associated with body mass index in a southern Chinese population.
24951660 rs186019316 and rs7596758 in TMEM18 is associated with body mass index.
24763707 TMEM18 mRNA expression levels are related to phenotypes of obesity and glucose metabolism.
23860325 results add to the evidence that BMI related variants in and near FTO and TMEM18 may increase the risk for T2D not only through secondary effects of obesity
23505181 In summary, moderately rare missense variants within the...TMEM18 genes observed in our study did not confer risk of common childhood obesity in African Americans...
23229156 Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated.
22466342 TMEM18rs6548238 associated with risk of diabetes after adjustment for body mass index.
22391885 By age 7, common variations in FTO, TMEM18 and NRXN3 influence the vulnerability to metabolic complications of sleep deprivation.
22083549 Variants of TMEM18 and FTO are associated with obesity indices during puberty in Chinese children.
21980424 TMEM18 localises to the nuclear membrane and binds to DNA in a sequence-specific manner: perhaps this closed perinuclear localisation of TMEM18-bound DNA might repress transcription from it.
21952719 We observed a strong positive correlation between TMEM18 expression and body weight in the prefrontal cortex (PFC) (r = 0.5694, P = 0.0003) indicating a potential role for TMEM18 in higher functions related to feeding involving the PFC.
21750520 Meta-analysis of 4992 subjects revealed seven SNPs near four loci, including NEGR1, TMEM18, SH2B1 /ATP2A1 and MC4R, showing significant association at 0.005
21720444 Our data suggest that SNPs in or near the TMEM18 locus contribute to obesity risk in the Greek population.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20628085 The polymorphisms rs6548238 and rs9935401 showed no association with educational level or income.
20628085 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20421936 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20386550 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20380707 TMEM18 is involved in both adult and childhood obesity and found in the majority of all brain sites, including the hypothalamus and the brain stem.
20380707 Observational study of gene-disease association. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19910938 The risk allele TMEM18 rs6548238 was associated with bodym mass index, higher waist circumference and total body fat.
19910938 Observational study of gene-disease association. (HuGE Navigator)
19851340 Data show that SNPs in SEC16B and TMEM18 were significantly associated with obesity, and the SNPs in GNPDA2, BDNF, FAIM2 and MC4R were marginally associated with obesity in Japanese.
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19746409 Observational study of gene-disease association. (HuGE Navigator)
19692490 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19164386 Observational study of gene-disease association. (HuGE Navigator)
19079261 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18559506 Overexpression of TMEM18 is associated with glioma

AA Sequence

MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYIN      1 - 70
EAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED     71 - 140
//

Text Mined References (56)

PMID Year Title
27029472 2016 The Drosophila ortholog of TMEM18 regulates insulin and glucagon-like signaling.
26365393 2015 Determination of obesity associated gene variants related to TMEM18 through ultra-deep targeted re-sequencing in a case-control cohort for pediatric obesity.
25640768 2015 Adult adiposity susceptibility loci, early growth and general and abdominal fatness in childhood: the Generation R Study.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25189249 2014 Polymorphisms in FTO, TMEM18 and PCSK1 are associated with BMI in southern Chinese population.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24951660 2014 Sequence variation in TMEM18 in association with body mass index: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24763707 2014 Adipose tissue depot specific promoter methylation of TMEM18.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24064335 2014 Meta-analysis of genome-wide association data identifies novel susceptibility loci for obesity.
23860325 2013 Polymorphisms in FTO and near TMEM18 associate with type 2 diabetes and predispose to younger age at diagnosis of diabetes.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23505181 2013 The missense variation landscape of FTO, MC4R, and TMEM18 in obese children of African Ancestry.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23229156 2013 Functional relevance of genes implicated by obesity genome-wide association study signals for human adipocyte biology.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22466342 2012 ?2-adrenergic receptor Thr164Ile polymorphism, obesity, and diabetes: comparison with FTO, MC4R, and TMEM18 polymorphisms in more than 64,000 individuals.
22391885 2013 Variations in the obesity genes FTO, TMEM18 and NRXN3 influence the vulnerability of children to weight gain induced by short sleep duration.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
22083549 2012 Study of eight GWAS-identified common variants for association with obesity-related indices in Chinese children at puberty.
21980424 2011 Obesity risk gene TMEM18 encodes a sequence-specific DNA-binding protein.
21952719 2012 Association of TMEM18 variants with BMI and waist circumference in children and correlation of mRNA expression in the PFC with body weight in rats.
21750520 2012 Implication of European-derived adiposity loci in African Americans.
21720444 2012 Common variants in FTO, MC4R, TMEM18, PRL, AIF1, and PCSK1 show evidence of association with adult obesity in the Greek population.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20725061 2011 MC4R variant is associated with BMI but not response to resistance training in young females.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20628085 2011 First investigation of two obesity-related loci (TMEM18, FTO) concerning their association with educational level as well as income: the MONICA/KORA study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20520848 2010 Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
20421936 2010 Two new Loci for body-weight regulation identified in a joint analysis of genome-wide association studies for early-onset extreme obesity in French and german study groups.
20386550 2010 Genes and lifestyle factors in obesity: results from 12,462 subjects from MONICA/KORA.
20380707 2010 The obesity gene, TMEM18, is of ancient origin, found in majority of neuronal cells in all major brain regions and associated with obesity in severely obese children.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19910938 2010 Novel obesity risk loci do not determine distribution of body fat depots: a whole-body MRI/MRS study.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19746409 2010 Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
19692490 2009 Obesity genes identified in genome-wide association studies are associated with adiposity measures and potentially with nutrient-specific food preference.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19164386 2009 Replication and extension of genome-wide association study results for obesity in 4923 adults from northern Sweden.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18559506 2008 Transmembrane protein 18 enhances the tropism of neural stem cells for glioma cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.