Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.400 1.9e-02
glioblastoma -3.700 1.4e-05
oligodendroglioma -1.200 1.7e-05
ependymoma -2.900 8.0e-09
medulloblastoma -1.800 2.2e-04
atypical teratoid / rhabdoid tumor -2.300 7.8e-05
medulloblastoma, large-cell -3.600 7.7e-04
primitive neuroectodermal tumor -2.300 1.0e-02
non-small cell lung cancer -2.133 2.1e-13
Breast cancer -1.900 2.9e-02
pediatric high grade glioma -3.200 7.6e-07
pilocytic astrocytoma -2.900 2.1e-08
subependymal giant cell astrocytoma -3.995 2.6e-03
breast carcinoma -1.500 1.9e-13
ductal carcinoma in situ -2.100 7.9e-03
invasive ductal carcinoma -2.400 2.1e-02
ovarian cancer 1.200 1.5e-02
pituitary cancer 2.100 1.1e-04

Gene RIF (1)

PMID Text
26644563 Tmem178 localizes to the ER membrane and regulates RANKL-induced Ca(2+) fluxes, thus controlling NFATc1 induction

AA Sequence

MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDS      1 - 70
PPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCT     71 - 140
AIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVA    141 - 210
GLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPF    211 - 280
ISRTKIAQLKSGRDSTV                                                         281 - 297
//

Text Mined References (8)

PMID Year Title
26644563 2015 Tmem178 acts in a novel negative feedback loop targeting NFATc1 to regulate bone mass.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.