Property Summary

NCBI Gene PubMed Count 9
PubMed Score 31.97
PubTator Score 17.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis -1.308 2.6e-02
Barrett's esophagus 2.000 2.2e-02
esophageal adenocarcinoma 2.300 1.8e-02
cutaneous lupus erythematosus 1.100 3.1e-02
glioblastoma 2.800 2.8e-04
chronic lymphosyte leukemia -1.400 2.3e-07
astrocytoma 2.000 3.6e-02
periodontitis 1.300 1.9e-25
tuberculosis 1.900 2.5e-02
pancreatic ductal adenocarcinoma liver m... -2.639 1.6e-02
lung cancer -1.600 1.4e-04
interstitial cystitis 1.300 1.1e-02
adult high grade glioma 1.300 1.9e-02
pilocytic astrocytoma 2.300 3.2e-09
primary Sjogren syndrome 1.100 4.7e-03
lung carcinoma 2.100 3.4e-23
ovarian cancer -3.400 2.3e-08
Down syndrome 1.200 4.4e-03
pancreatic cancer 1.700 3.0e-03
head and neck cancer and chronic obstruc... 1.400 1.5e-03

Gene RIF (1)

PMID Text
22244448 human TMEM176A and 176B protein levels are significantly elevated in lymphoma, but not in normal tissues

AA Sequence

MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQLALGVT      1 - 70
QILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHPGKLAGYISSLLTLAGFATAM     71 - 140
AAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRALF    141 - 210
LAVCVLKVIVSLVSLGVGLRNLCGQSSQPLNEEGSEKRLLGENSVPPSPSREQTSTAIVL              211 - 270
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22244448 2012 Abnormal accumulation of human transmembrane (TMEM)-176A and 176B proteins is associated with cancer pathology.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16095493 2005 Identification of a new member of the CD20/FcepsilonRIbeta family overexpressed in tolerated allografts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967007 2002 Gene expression profile of renal proximal tubules regulated by proteinuria.
9922225 1999 Isolation of a gene product expressed by a subpopulation of human lung fibroblasts by differential display.