Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.364 6.4e-04
adult high grade glioma -1.300 2.3e-03
Atopic dermatitis -1.400 1.1e-03
atypical teratoid / rhabdoid tumor -2.700 1.8e-06
ductal carcinoma in situ -1.400 6.9e-03
glioblastoma -1.100 1.7e-03
invasive ductal carcinoma -2.000 1.4e-03
medulloblastoma -1.400 3.4e-06
medulloblastoma, large-cell -2.200 3.5e-07
non-small cell lung cancer -1.313 4.6e-21
osteosarcoma -2.038 8.6e-03
ovarian cancer -1.400 9.6e-04
pancreatic ductal adenocarcinoma liver m... -1.126 1.1e-02
pituitary cancer 1.300 5.3e-04
tuberculosis 2.200 6.8e-05

AA Sequence

MKAEGGDHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVI      1 - 70
SVIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLTLIISFSRILATL             71 - 132
//

Text Mined References (2)

PMID Year Title