Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.18
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.020 7.4e-03
ependymoma 1.200 2.1e-07
atypical teratoid / rhabdoid tumor 1.100 1.4e-04
juvenile dermatomyositis 1.011 6.7e-12
primary pancreatic ductal adenocarcinoma 1.540 9.6e-04
invasive ductal carcinoma 1.100 2.8e-02
ulcerative colitis -1.300 9.2e-09
ovarian cancer -1.400 1.4e-03

Gene RIF (2)

PMID Text
23152477 This study identified rs4888378 in the BCAR1-CFDP1-TMEM170A locus as a novel genetic determinant of carotid intima-media thickness and coronary artery disease risk.
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLAL      1 - 70
FTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRI     71 - 140
LATL                                                                      141 - 144
//

Text Mined References (10)

PMID Year Title
26906412 2016 Transmembrane protein TMEM170A is a newly discovered regulator of ER and nuclear envelope morphogenesis in human cells.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23152477 2012 Identification of the BCAR1-CFDP1-TMEM170A locus as a determinant of carotid intima-media thickness and coronary artery disease risk.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.