Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.234 1.2e-04
Astrocytoma, Pilocytic 1.100 1.1e-04
breast carcinoma 1.100 7.3e-17
diabetes mellitus -1.100 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
juvenile dermatomyositis 1.247 3.1e-07
osteosarcoma 1.703 5.8e-04
ovarian cancer -1.300 1.3e-06
primary pancreatic ductal adenocarcinoma 1.119 9.0e-03
progressive supranuclear palsy -1.100 7.4e-03

AA Sequence

MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF      1 - 70
IQ                                                                         71 - 72
//

Text Mined References (10)

PMID Year Title