Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.37
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.300 2.8e-04
astrocytic glioma -1.700 1.5e-02
Astrocytoma, Pilocytic -1.200 2.0e-03
atypical teratoid / rhabdoid tumor -1.600 7.1e-05
ependymoma -2.200 1.6e-02
glioblastoma -1.100 2.1e-03
medulloblastoma -1.300 1.6e-03
medulloblastoma, large-cell -1.900 5.4e-05
oligodendroglioma -1.500 3.5e-02
primitive neuroectodermal tumor -1.300 6.6e-03

Gene RIF (1)

AA Sequence

MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETA      1 - 70
FLSWFRNGLLASGIGVISFMQSDMGREAAYGFFLLGGLCVVWGSASYAVGLAALRGPMQLTLGGAAVGAG     71 - 140
AVLAASLLWACAVGLYMGQLELDVELVPEDDGTASAEGPDEAGRPPPE                          141 - 188
//

Text Mined References (8)

PMID Year Title