Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.37
PubTator Score 95.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 2.000 1.8e-04
malignant mesothelioma -5.000 9.3e-09
astrocytic glioma -1.700 8.9e-03
psoriasis 1.800 1.4e-03
osteosarcoma 2.344 1.3e-03
cystic fibrosis 4.539 9.3e-08
glioblastoma 2.000 3.9e-02
juvenile dermatomyositis 1.388 5.3e-09
primary pancreatic ductal adenocarcinoma 1.934 1.4e-03
non-small cell lung cancer 2.505 8.1e-13
intraductal papillary-mucinous adenoma (... -1.100 8.7e-05
X-linked cerebral adrenoleukodystrophy -1.700 2.7e-02
lung cancer 3.900 1.7e-05
active Crohn's disease 2.164 1.2e-03
interstitial cystitis 2.600 2.2e-06
pancreatic carcinoma 2.000 1.8e-04
lung adenocarcinoma 1.300 2.4e-04
gastric carcinoma 2.600 1.2e-02
ulcerative colitis 3.000 2.0e-08
ovarian cancer 3.500 9.1e-04
pituitary cancer -4.200 9.3e-12

Gene RIF (2)

PMID Text
16737913 RIS1 exhibits frameshift mutations in high-frequency microsatellite instability tumors, and its alteration is correlated with mutations in two target genes BAX and TGFBR2, linking it to the mutator pathway in colorectal carcinogenesis.
16280139 Suggested role of Ris-1 as tumor suppressor gene is not evident, at least in breast cancer.

AA Sequence

MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAA      1 - 70
AAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDL     71 - 140
RLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGE    141 - 210
PGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVPAGTTAA    211 - 280
AAAAAAAAAAAAVTSGVATK                                                      281 - 300
//

Text Mined References (13)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16737913 2006 RIS1, a gene with trinucleotide repeats, is a target in the mutator pathway of colorectal carcinogenesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16575872 2006 Target genes of the WNT/beta-catenin pathway in Wilms tumors.
16280139 2006 Analysis of the candidate tumor suppressor Ris-1 in primary human breast carcinomas.
16083501 2005 Tumor suppressor in lung cancer 1 (TSLC1) alters tumorigenic growth properties and gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486950 2004 Microdissection and SAGE as a combined tool to reveal gene expression in ductal carcinoma in situ of the breast.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11822868 2002 Identification of a candidate tumor-suppressor gene specifically activated during Ras-induced senescence.
11399754 2001 Identification and molecular cloning of a novel brain-specific receptor protein that binds to brain injury-derived neurotrophic peptide. Possible role for neuronal survival.