Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.89
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cystic fibrosis 3.064 3.1e-05
ductal carcinoma in situ 1.300 1.4e-03
Endometriosis -1.778 1.3e-02
interstitial cystitis -1.400 8.5e-03
intraductal papillary-mucinous adenoma (... 2.500 4.5e-04
intraductal papillary-mucinous neoplasm ... 2.900 2.1e-03
lung carcinoma -2.600 1.1e-22
nasopharyngeal carcinoma -1.200 4.3e-06
osteosarcoma -1.998 2.4e-02
pancreatic cancer 1.300 6.1e-05
spina bifida -1.540 3.2e-02
ulcerative colitis 1.700 4.2e-05

Gene RIF (1)

AA Sequence

MQAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPD      1 - 70
ENQLEFILMVLIPLILLVLLLLSVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPS     71 - 140
VMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES                               141 - 183
//

Text Mined References (8)

PMID Year Title