Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.400 1.0e-04
Amyotrophic lateral sclerosis -1.024 7.4e-06
astrocytoma -1.100 1.3e-13
Astrocytoma, Pilocytic -1.700 2.3e-05
atypical teratoid / rhabdoid tumor -2.000 1.3e-08
ependymoma -1.100 3.1e-02
glioblastoma -1.900 6.8e-07
group 3 medulloblastoma -1.200 3.3e-02
medulloblastoma, large-cell -1.900 1.5e-05
oligodendroglioma -1.200 1.9e-12
ovarian cancer -1.400 8.8e-13
primitive neuroectodermal tumor -1.300 3.1e-04

AA Sequence

MPEDGAGDGGEVPALIPDGEPLREEQRPLKQSLGSSLCRESHWKCLLLTLLIHACGAVVAWCRLATVPRL      1 - 70
VLGPEAALARGAGGPPPTYPASPCSDGYLYIPLAFVSLLYLLYLAECWHCHVRSCQAPRTDAHTVLALIR     71 - 140
RLQQAPPCVWWKATSYHYVRRTRQITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGL    141 - 210
AEHAATRLRFTKCFSFGSAEAEASYLTQRARFFSANEGLDDYLEAREGMHLKDVDFRESLMVFADPRSPP    211 - 280
WYARAWVFWLVSAATLSWPLRVVAAYGTAHVHYQVEKLFGASSPPPGAVPSGPPLSRVATVDFTELEWHI    281 - 350
CSNRQLVPSYSEAVVMGAGSGAYLRGCQRCRRSVSSNSLPPARPSGPRLPFSRSRLSLGAGGRATPGVFR    351 - 420
SLSGGPLGRRGEDTEPLESPPCYEDALYFPVLIVHGDSGCQGDGQGAL                          421 - 468
//

Text Mined References (5)

PMID Year Title