Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.40
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.894 9.8e-04
adult high grade glioma -1.600 4.9e-02
aldosterone-producing adenoma -1.890 3.1e-02
astrocytoma -1.100 5.5e-07
atypical teratoid / rhabdoid tumor -2.800 2.5e-04
Breast cancer 2.600 3.0e-02
cystic fibrosis 1.980 8.6e-05
glioblastoma -1.200 1.8e-02
head and neck cancer -1.200 2.1e-03
intraductal papillary-mucinous carcinoma... -2.500 2.3e-03
medulloblastoma -1.400 4.6e-02
medulloblastoma, large-cell -4.800 1.1e-04
oligodendroglioma -2.300 3.9e-02
osteosarcoma -1.640 1.8e-02
ovarian cancer -3.400 3.7e-08
pituitary cancer -1.800 2.0e-05
posterior fossa group A ependymoma 1.200 1.3e-03

AA Sequence

MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAERKPGVKHAPYISIAGDDPPASCVFSQ      1 - 70
VMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFG     71 - 140
TLTCWIQAALTLKVNIKNEGRRVGIPRVILSASITLCVVLYFILMAQSIHMYAARVQWGLVMCFLSYFGT    141 - 210
FAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV                                   211 - 249
//

Text Mined References (10)

PMID Year Title