Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.45
PubTator Score 0.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.5e-04
Multiple myeloma 1327 5.5e-04
lung cancer 4473 2.4e-03
glioblastoma 5572 2.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.444 5.5e-04
glioblastoma 1.100 2.8e-03
lung cancer 1.200 2.4e-03
ovarian cancer 1.600 1.5e-04

Gene RIF (1)

PMID Text
20538592 TMEM147 is a novel core component of the Nicalin-NOMO complex, further emphasizing its similarity with gamma-secretase.

AA Sequence

MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGE      1 - 70
FMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSN     71 - 140
ISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLAL    141 - 210
STLALYVAVVNVHS                                                            211 - 224
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20538592 2010 Transmembrane protein 147 (TMEM147) is a novel component of the Nicalin-NOMO protein complex.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.