Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.5e-02
pancreatic cancer 1.600 4.0e-05
astrocytic glioma -3.400 3.2e-02
ependymoma -3.600 3.0e-02
glioblastoma -2.000 1.2e-02
oligodendroglioma -1.900 9.3e-07
osteosarcoma -1.369 1.5e-02
group 3 medulloblastoma -4.400 2.7e-04
atypical teratoid/rhabdoid tumor -3.200 1.8e-06
medulloblastoma, large-cell -3.600 1.3e-03
primitive neuroectodermal tumor -2.500 8.1e-03
tuberculosis 1.400 2.5e-04
intraductal papillary-mucinous adenoma (... 1.400 6.7e-03
intraductal papillary-mucinous neoplasm ... 2.300 4.8e-03
lung cancer -2.000 1.6e-02
interstitial cystitis -1.300 2.8e-03
pediatric high grade glioma -2.400 6.5e-04
pilocytic astrocytoma -2.200 2.2e-04
non primary Sjogren syndrome sicca -1.200 2.6e-02
pancreatic carcinoma 1.600 4.0e-05
subependymal giant cell astrocytoma -2.374 5.0e-03
Endometriosis -1.246 3.1e-02
lung carcinoma -1.800 5.2e-23
Pick disease -1.800 1.9e-02
progressive supranuclear palsy -2.500 1.9e-02
ovarian cancer 1.100 1.8e-03
Down syndrome 2.700 6.7e-04

AA Sequence

MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAML      1 - 70
GGCIWATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFGLDAEEVSNPLLNYIGAGLSVVSAF     71 - 140
IFLFIKSEIPNNTCSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRIVGCSLAVISGVLYGSTFVPIIYI    141 - 210
KDHSKRNDSIYAGASQYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPEAVLPGFLSGVLWAIATC    211 - 280
CWFIANHSLSAVVSFPIITAGPGFIAAMWGIFMFKEIKGLQNYLLMILAFCIILTGALCTAFSKI         281 - 345
//

Text Mined References (4)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.