Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.200 3.3e-04
lung carcinoma 1.600 1.2e-27
non primary Sjogren syndrome sicca 1.100 2.6e-02

AA Sequence

MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVA      1 - 70
GSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS                                     71 - 108
//

Text Mined References (8)

PMID Year Title