Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.30
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer -1.200 5.8e-03
diabetes mellitus 1.200 1.0e-03
interstitial cystitis -1.700 9.3e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
lung adenocarcinoma -1.200 8.6e-06
lung carcinoma -1.100 5.7e-18
non-small cell lung cancer -2.416 1.1e-25
ovarian cancer 2.500 1.6e-08
pituitary cancer -1.100 9.0e-05
primary pancreatic ductal adenocarcinoma 1.008 3.0e-02
psoriasis -1.400 1.1e-39

Gene RIF (2)

AA Sequence

MVPMHLLGRLEKPLLLLCCASFLLGLALLGIKTDITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSM      1 - 70
QTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIPPAPEEEQPSHPEGSRRAKLE     71 - 140
QRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPPPAYDVCFGHPDDDSVFYE    141 - 210
DNWAPP                                                                    211 - 216
//

Text Mined References (16)

PMID Year Title