Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.90
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MAALSKSIPHNCYEIGHTWHPSCRVSFLQITGGALEESLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQ      1 - 70
SASFLTANGALYMAFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRM     71 - 140
GVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSFSPEAAYAKVEQKR    141 - 210
EQHEEKPGRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRH    211 - 280
LFTQPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIIAGFLAGISMMFYKSTTIS    281 - 350
MYLASKLVETMYFKGIEAGKVPYFPHADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMN    351 - 420
RKVLDVFGTGASKHFQDFIPRLDPRYTTVTPELPTEFS                                    421 - 458
//

Text Mined References (11)

PMID Year Title