Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.74
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6514 1.5e-30
Astrocytoma, Pilocytic 3006 1.6e-07
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Kidney cancer 2548 0.0 0.6
Disease Target Count Z-score Confidence
Nonsyndromic deafness 137 0.0 4.0
Disease Target Count Z-score Confidence
Panic disorder 57 3.253 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.6e-07
psoriasis -1.600 1.5e-30

Gene RIF (1)

AA Sequence

MAPGMSGRGGAALLCLSALLAHASGRSHPASPSPPGPQASPVLPVSYRLSHTRLAFFLREARPPSPAVAN      1 - 70
SSLQRSEPFVVFQTKELPVLNVSLGPFSTSQVVARELLQPSSTLDIPERLTVNWKVRAFIVRSHVPASQP     71 - 140
VVQVLFYVAGRDWDDFGVTERLPCVRLHAFRDAREHPLLRIGSISLFRPPPRRTLQEHRLDSNLMIRLPD    141 - 210
RPLKPGEVLSILLYLAPNSSSPSSPSVEHFTLRVKAKKGVTLLGTKSRSGQWHVTSELLTGAKHSTATVD    211 - 280
VAWAQSTPLPPREGQGPLEILQLDFEMENFTSQSVKRRIMWHIDYRGHGALPDLERAVTELTVIQRDVQA    281 - 350
ILPLAMDTEIINTAILTGRTVAIPVKVIAIEVNGLVLDISALVECESDNEDIIKVSSSCDYVFVSGKESR    351 - 420
GSMNARVTFRYDVLNAPLEMTVWVPKLPLHIELSDARLSQVKGWRVPILPDRRSVRESEDEDEEEEERRQ    421 - 490
SASRGCTLQYQHATLQVFTQFHTTSSEGTDQVVTMLGPDWLVEVTDLVSDFMRVGDPRVAHMVDSSTLAG    491 - 560
LEPGTTPFKVVSPLTEAVLGETLLTVTEEKVSITQLQAQVVASLALSLRPSPGSSHTILATTAAQQTLSF    561 - 630
LKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELLRAELTIA    631 - 700
ESCQKTKRKSVLATTPVGLRVHFGRDEEDPTYDYPGPSQPGPGGGEDEARGAGPPGSALPAPEAPGPGTA    701 - 770
SPVVPPTEDFLPLPTGFLQVPRGLTDLEIGMYALLGVFCLAILVFLINCIVFVLRYRHKRIPPEGQTSMD    771 - 840
HSHHWVFLGNGQPLRVQGELSPPAGNPLETVPAFCHGDHHSSGSSQTSVQSQVHGRGDGSSGGSARDQAE    841 - 910
DPASSPTSKRKRVKFTTFTTLPSEELAYDSVPAGEEDEEEEEDLGWGCPDVAGPTRPTAPPDLHNYMRRI    911 - 980
KEIA                                                                      981 - 984
//

Text Mined References (10)

PMID Year Title