Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.86
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.6e-06
ovarian cancer 8491 3.2e-06
medulloblastoma, large-cell 6234 3.0e-03
breast carcinoma 1614 3.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.386 2.6e-06
medulloblastoma, large-cell -1.200 3.0e-03
breast carcinoma 1.100 3.4e-02
ovarian cancer 1.800 3.2e-06

Gene RIF (4)

PMID Text
26210183 TRC8 and TMEM129 are endoplasmic reticulum-associated degradation ubiquitin E3 ligases for viral and cellular targeting of MHC class I. (Review)
25030448 TMEM129 contains an unusual cysteine-only RING with intrinsic E3 ligase activity and is recruited to US11 via Derlin-1.
24807418 TMEM129 is an integral part of the Endoplasmic Reticulum-resident dislocation complex mediating US11-induced HLA class I degradation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGY      1 - 70
YVGMCLAASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQA     71 - 140
VASSVNTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLL    141 - 210
TIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNPAYSVPSSQ    211 - 280
ELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFASRQDPLRPDTWLASRVPCPTCR    281 - 350
ARFCILDVCTVR                                                              351 - 362
//

Text Mined References (10)

PMID Year Title
26210183 2015 Identifying the ERAD ubiquitin E3 ligases for viral and cellular targeting of MHC class I.
25030448 2014 TMEM129 is a Derlin-1 associated ERAD E3 ligase essential for virus-induced degradation of MHC-I.
24807418 2014 A high-coverage shRNA screen identifies TMEM129 as an E3 ligase involved in ER-associated protein degradation.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20348956 2010 A sequence variant at 4p16.3 confers susceptibility to urinary bladder cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.