Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.39
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (3)

AA Sequence

MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTA      1 - 70
KRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVCVPGLFLLLVALDRMEYVRTF     71 - 140
RKREDLRGRLFWVALDLLDLLDMQASLWEPPRSGLPLWAEGLTFFYCYMLLLVLPCVALSEVSMQGEHIA    141 - 210
PQKMMLYPVLSLATVNVVAVLARAANMALFRDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALS    211 - 280
LELQPPPPQRNSVPPPPPPLHGPPGRPHMSSPTRDPLDT                                   281 - 319
//

Text Mined References (6)

PMID Year Title