Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.83
PubTator Score 6.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Microphthalmia 76 3.55 1.8

Gene RIF (2)

AA Sequence

MRVHLGGLAGAAALTGALSFVLLAAAIGTDFWYIIDTERLERTGPGAQDLLGSINRSQPEPLSSHSGLWR      1 - 70
TCRVQSPCTPLMNPFRLENVTVSESSRQLLTMHGTFVILLPLSLILMVFGGMTGFLSFLLQAYLLLLLTG     71 - 140
ILFLFGAMVTLAGISVYIAYSAAAFREALCLLEEKALLDQVDISFGWSLALGWISFIAELLTGAAFLAAA    141 - 210
RELSLRRRQDQAI                                                             211 - 223
//

Text Mined References (10)

PMID Year Title