Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.520 2.2e-03
atypical teratoid / rhabdoid tumor -1.800 1.5e-03
glioblastoma -1.400 4.0e-02
medulloblastoma, large-cell -2.100 1.5e-05
adrenocortical carcinoma -1.653 3.9e-03
non-small cell lung cancer -1.503 2.0e-16
group 4 medulloblastoma 1.600 4.4e-05
posterior fossa group B ependymoma 1.300 5.2e-10
aldosterone-producing adenoma -1.217 2.3e-02
subependymal giant cell astrocytoma -2.233 4.7e-02
lung carcinoma 1.300 1.1e-04
Breast cancer -1.100 1.1e-03
pituitary cancer 2.100 5.6e-05
psoriasis -1.600 6.3e-76

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRHTSVVMLTPNP      1 - 70
DGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPAAMATTSSKPEGRPRGQAAPT     71 - 140
ILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQK    141 - 210
RPLGKIFQIYKGNFTGSVEPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGL    211 - 280
RRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSS    281 - 350
GVFTAATGPTPAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST    351 - 420
VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVC    421 - 490
CMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPF    491 - 560
CQETLFVGNDQVSEI                                                           561 - 575
//

Text Mined References (12)

PMID Year Title
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.