Property Summary

NCBI Gene PubMed Count 41
PubMed Score 28.46
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

 GWAS Trait (1)

Pathway (1)

Gene RIF (27)

PMID Text
26651479 Endogenous TMEM106B was partly sequestered in CHMP2B-positive structures. The roles of SNPs T185, S185, or S134N in endosomal sorting complexes required for transport were studied. T185 is a risk factor in neurodegeneration with endolysosomal defects.
25653292 Common variants in TMEM106B serve as a distinct risk factor for TDP-43 pathology in older persons without frontotemporal lobe dementia.
25470345 This study confirmed that specific TMEM106B single-nucleotide polymorphisms is associated with HS-Aging pathology in the Alzheimer disease.
25114081 TMEM106b variability does not influence Alzheimer disease risk or plasma progranulin levels.
25096617 Study suggests that TMEM106B is associated with frontotemporal dementia, although the extent of this effect is difficult to be estimated by using clinical frontotemporal dementia series
25085782 It is a risk factor for frontotemporal lobar degeneration.
25066864 Neuronal TMEM106B plays a central role in regulating lysosomal size, motility and responsiveness to stress, highlighting the possible role of lysosomal biology in FTLD-TDP.
24899141 The HpScl groups (Hippocampual Sclerosis and Hippocampual Sclerosis-AD) were more likely to exhibit genetic variants in TMEM106B that are associated with frontotemporal lobar degeneration.
24872421 Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a).
24731779 results show that, in nondemented persons, TMEM106B influences the volume of temporal brain regions that are important for language processing.
24442578 Study demonstrates that TMEM106B is the first reported genetic modifier in C9orf72 expansion-related frontotemporal lobar degeneration
24385136 Study identifies TMEM106B as the first genetic factor modifying disease presentation in C9ORF72 expansion carriers
24357581 These data show that TMEM106B/MAP6 interaction is crucial for controlling dendritic trafficking of lysosomes, presumably by acting as a molecular brake for retrograde transport.
24343233 TMEM106B polymorphism modulates brain connectivity in granulin mutation carriers.
24252750 Data provide an initial neuropathological characterization of the newly discovered frontotemporal lobar degeneration-associated protein TMEM106B
24166182 This study demonstrate that TMEM106B and APOE interact to increase late-onset Alzheimer's disease in Han Chinese.
23742080 These findings suggest that low TMEM106B levels might protect against frontotemporal lobar degeneration TAR DNA binding protein 43 in these patients
23136129 TMEM106B is localized in the late endosome/lysosome compartments and TMEM106B levels are regulated by lysosomal activities.
22895706 This study demonistrated that aberrant overexpression of TMEM106B affects the distribution and intracellular levels of progranulin, suggesting that the two proteins may act in the same pathogenic pathway in FTLD-TDP.
22855871 Our data implicate TMEM106B in the pathological presentation of Alzheimer Disease.
22511793 Endogenous as well as overexpressed TMEM106B localizes to late endosomes and lysosomes. Interestingly, the inhibition of vacuolar H(+)-ATPases significantly increased the levels of TMEM106B.
21354975 This study strongly supported TMEM106B as a risk gene for frontotemporal lobar degeneration.
21220649 Our results suggest that genetic variation in TMEM106B (rs1990622) may influence risk for frontotemporal lobar degeneration with TAR DNA-binding protein inclusions (FTLD-TDP) by modulating secreted levels of GRN.
21104415 FTLD-TDP risk gene TMEM106B is involved in the development of cognitive impairment in amyotrophic lateral sclerosis.
20383883 The genome-wide association study revealed a strong association between FTLD-TDP and several single nucleotide polymorphisms (SNPs) that mapped in the region of the TMEM106B gene
20154673 Variants in TMEM106B are strong risk factors for frontotemporal lobar degeneration with TDP-43 inculsions.
20154673 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRI      1 - 70
PRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKR     71 - 140
TIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYM    141 - 210
YDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ          211 - 274
//

Text Mined References (47)

PMID Year Title
26651479 2015 TMEM106B, a frontotemporal lobar dementia (FTLD) modifier, associates with FTD-3-linked CHMP2B, a complex of ESCRT-III.
25653292 2015 The TMEM106B locus and TDP-43 pathology in older persons without FTLD.
25470345 2015 Reassessment of risk genotypes (GRN, TMEM106B, and ABCC9 variants) associated with hippocampal sclerosis of aging pathology.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25114081 2015 Transmembrane protein 106B gene (TMEM106B) variability and influence on progranulin plasma levels in patients with Alzheimer's disease.
25096617 2015 Association of TMEM106B rs1990622 marker and frontotemporal dementia: evidence for a recessive effect and meta-analysis.
25085782 2014 Defining the association of TMEM106B variants among frontotemporal lobar degeneration patients with GRN mutations and C9orf72 repeat expansions.
25066864 2014 Lysosome size, motility and stress response regulated by fronto-temporal dementia modifier TMEM106B.
24899141 2014 Differential clinicopathologic and genetic features of late-onset amnestic dementias.
24872421 2014 Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a).
24731779 2014 TMEM106B influences volume of left-sided temporal lobe and interhemispheric structures in the general population.
24488309 2014 TMEM106B: a strong FTLD disease modifier.
24442578 2014 TMEM106B is a genetic modifier of frontotemporal lobar degeneration with C9orf72 hexanucleotide repeat expansions.
24385136 2014 TMEM106B protects C9ORF72 expansion carriers against frontotemporal dementia.
24357581 2014 The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes.
24343233 2014 Effect of TMEM106B polymorphism on functional network connectivity in asymptomatic GRN mutation carriers.
24252750 2013 Expression of TMEM106B, the frontotemporal lobar degeneration-associated protein, in normal and diseased human brain.
24166182 2014 TMEM106B and APOE polymorphisms interact to confer risk for late-onset Alzheimer's disease in Han Chinese.
23742080 2013 TMEM106B p.T185S regulates TMEM106B protein levels: implications for frontotemporal dementia.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23136129 2013 The frontotemporal lobar degeneration risk factor, TMEM106B, regulates lysosomal morphology and function.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22895706 2012 TMEM106B, the risk gene for frontotemporal dementia, is regulated by the microRNA-132/212 cluster and affects progranulin pathways.
22889924 2013 Genome-wide association study of Tourette's syndrome.
22855871 2012 TMEM106B risk variant is implicated in the pathologic presentation of Alzheimer disease.
22511793 2012 Membrane orientation and subcellular localization of transmembrane protein 106B (TMEM106B), a major risk factor for frontotemporal lobar degeneration.
21354975 2011 TMEM106B is associated with frontotemporal lobar degeneration in a clinically diagnosed patient cohort.
21220649 2011 Association of TMEM106B gene polymorphism with age at onset in granulin mutation carriers and plasma granulin protein levels.
21178100 2011 TMEM106B regulates progranulin levels and the penetrance of FTLD in GRN mutation carriers.
21104415 2011 Risk genotypes at TMEM106B are associated with cognitive impairment in amyotrophic lateral sclerosis.
20383883 2010 TMEM106B is a susceptibility locus for Ftld.
20154673 2010 Common variants at 7p21 are associated with frontotemporal lobar degeneration with TDP-43 inclusions.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.