Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.79
PubTator Score 4.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.463 4.3e-02
adult high grade glioma 2.500 2.6e-04
astrocytic glioma 3.300 3.0e-02
Astrocytoma, Pilocytic 3.000 2.8e-07
Atopic dermatitis -1.200 6.8e-03
atypical teratoid / rhabdoid tumor -2.000 1.7e-03
breast carcinoma -1.900 5.8e-06
colon cancer -2.900 1.4e-05
cutaneous lupus erythematosus 1.300 1.8e-02
ductal carcinoma in situ -2.900 1.0e-03
fibroadenoma -1.900 8.3e-03
glioblastoma 1.800 2.2e-04
intraductal papillary-mucinous adenoma (... -2.900 1.8e-03
intraductal papillary-mucinous carcinoma... -4.000 8.0e-04
intraductal papillary-mucinous neoplasm ... -4.400 2.6e-03
invasive ductal carcinoma -4.300 2.5e-04
lung adenocarcinoma -3.500 1.8e-18
lung cancer -5.600 2.6e-08
lung carcinoma -4.000 4.0e-16
medulloblastoma -1.500 4.4e-02
medulloblastoma, large-cell -2.400 7.7e-06
non-small cell lung cancer -5.073 4.8e-30
oligodendroglioma 3.000 1.4e-02
pituitary cancer -2.900 2.3e-07

Gene RIF (4)

AA Sequence

MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIV      1 - 70
VTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA           71 - 134
//

Text Mined References (14)

PMID Year Title