Property Summary

NCBI Gene PubMed Count 52
PubMed Score 86.03
PubTator Score 169.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.100 1.6e-05
astrocytic glioma -1.300 1.9e-02
atypical teratoid / rhabdoid tumor -3.500 1.2e-03
cystic fibrosis 1.749 8.8e-06
ependymoma -1.700 3.1e-02
glioblastoma -2.200 1.6e-03
group 3 medulloblastoma -1.900 2.3e-02
medulloblastoma, large-cell -2.900 1.3e-03
oligodendroglioma -1.300 3.0e-02
Pick disease -1.700 5.0e-03

Gene RIF (28)

AA Sequence

MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYDDRENDLFLCD      1 - 70
TNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAG     71 - 140
SGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKE    141 - 210
ASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEH    211 - 280
SINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNR    281 - 350
IHRQKQNTGHYSSDNTTRASTRLI                                                  351 - 374
//

Text Mined References (55)

PMID Year Title