Property Summary

NCBI Gene PubMed Count 52
PubMed Score 81.24
PubTator Score 169.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.400 7.5e-06
posterior fossa group B ependymoma -4.700 3.6e-16
oligodendroglioma -1.300 3.0e-02
glioblastoma -3.200 2.6e-03
group 4 medulloblastoma -3.900 4.8e-05
cystic fibrosis 1.749 8.8e-06
atypical teratoid / rhabdoid tumor -3.500 1.2e-03
medulloblastoma, large-cell -2.900 1.3e-03
pediatric high grade glioma -2.600 6.9e-04
Pick disease -1.700 5.0e-03

Gene RIF (28)

PMID Text
26402097 Results suggest that TMEFF2 is a brain-enriched endogenous modulator of Abeta neurotoxicity and an enhancer of alpha-secretase processing of AbetaPP
25573902 TMEFF2 regulates the non-canonical activin/BMP4 signaling, PI3K, and Ras/ERK1/2 pathways.
24987055 TMEFF2 acts as a tumor suppressor in gastric cancer through direct interaction with SHP-1 and can be a potential biomarker of carcinogenesis.
24919179 c-Myc contributes to the epigenetic regulation of HPP1 via the dominant recruitment of HDAC3.
23824605 TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells.
23405127 Androgen signaling promotes eIF2alpha phosphorylation and subsequent translation of TMEFF2 via a mechanism that requires uORFs in the 5'-UTR of TMEFF2.
22814847 Findings suggest that methylation-associated down-regulation of TMEFF2 gene may be involved in lung tumorigenesis and TMEFF2 methylation can serve as a specific blood-based biomarker for NSCLC.
22532293 Methylation of TMEFF2 gene is associated with colorectal neoplasia in ulcerative colitis and Crohn's colitis.
22238370 Several genes expressed at exceptionally high levels were identified associated with early oocyte development, TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1) and the mitochondrial-encoded ATPase6 (ATP6).
21559523 TMEFF2 can function to regulate PDGF signaling; it is hypermethylated and downregulated in glioma and several other cancers
21393249 the tumor suppressor activity of TMEFF2 requires the cytoplasmic/transmembrane portion of the protein and correlates with its ability to bind to SARDH and to modulate the level of sarcosine.
20975101 GDF15, HSPA2, TMEFF2, and VIM were identified as epigenetic biomarkers for Bladder cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19288010 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19040536 promoter of TPEF gene is frequently hpermethylated, and associated with loss of TPEF mRNA expression in esophageal squamous cell carcinoma
18799374 Distinct TPEF/HPP1 (transmembrane protein containing epidermal growth factor) gene methylation patterns in gastric cancer indicate a field effect in gastric carcinogenesis.
18070176 Methylated PAX6- or TPEF-promoters could represent biomarkers for bladder cancer.
18059030 data provides evidence to support the role of HPP1 as a tumor suppressor gene; activation of the STAT1 pathway likely represents the principal mediator of HPP1's tumor suppressive properties
17942404 TMEFF2 contributes to cell proliferation in an ADAM17-dependent autocrine fashion in cells expressing this protein
17352030 Methylation testing of fecal DNA using a panel of epigenetic markers (methylated SFRP2, HPP1 and MGMT) may be a simple and promising non-invasive screening method for colorectal carcinoma and precancerous lesions.
16619216 Hypermethylation of HPP1 is associated with primary adenocarcinomas of the small bowel
16439095 A secreted form of TMEFF2 is expressed from TMEFF2 locus and may functionally interact with full-length TMEFF2, or its binding partners, and may also influence current immune-based treatment strategies
15824739 Hypermethylation of p16, RUNX3, and HPP1 in Barreett exophagus may represent independent risk factors for the progression of Barrett esophagus to esophageal cancer.
15068392 Analysis of DNA from peripheral blood revealed that TPEF methylation was detectable in colorectal tumor patients and patients with early or pre-neoplastic lesions, but not in healthy volunteers.
12729735 inverse correlation between TMEFF2 and c-Myc expression
12460892 Aberrant methylation of the HPP1 gene is a relative common early event in ulcerative colitis-associated colorectal carcinoma.
12384516 Hypermethylation of HPP1 is associated with hMLH1 hypermethylation in gastric adenocarcinomas.

AA Sequence

MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYDDRENDLFLCD      1 - 70
TNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAG     71 - 140
SGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKE    141 - 210
ASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEH    211 - 280
SINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNR    281 - 350
IHRQKQNTGHYSSDNTTRASTRLI                                                  351 - 374
//

Text Mined References (55)

PMID Year Title
26402097 2015 Tomoregulin (TMEFF2) Binds Alzheimer's Disease Amyloid-? (A?) Oligomer and A?PP and Protects Neurons from A?-Induced Toxicity.
25644509 2015 Four DNA methylation biomarkers in biliary brush samples accurately identify the presence of cholangiocarcinoma.
25573902 2015 TMEFF2 is an endogenous inhibitor of the CRH signal transduction pathway.
25123395 2014 Validation of DNA promoter hypermethylation biomarkers in breast cancer--a short report.
25042611 2014 The genetics of hemoglobin A2 regulation in sickle cell anemia.
24996057 2015 Bidirectional regulation between TMEFF2 and STAT3 may contribute to Helicobacter pylori-associated gastric carcinogenesis.
24987055 2014 TMEFF2 deregulation contributes to gastric carcinogenesis and indicates poor survival outcome.
24919179 2014 The interplay between histone deacetylases and c-Myc in the transcriptional suppression of HPP1 in colon cancer.
24632071 2014 The TMEFF2 tumor suppressor modulates integrin expression, RhoA activation and migration of prostate cancer cells.
24100025 2014 Accurate detection of upper tract urothelial carcinoma in tissue and urine by means of quantitative GDF15, TMEFF2 and VIM promoter methylation.
23936739 2013 TMEFF2 modulates the AKT and ERK signaling pathways.
23824605 2013 TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells.
23405127 2013 Androgen signaling promotes translation of TMEFF2 in prostate cancer cells via phosphorylation of the ? subunit of the translation initiation factor 2.
22814847 2012 Methylation of TMEFF2 gene in tissue and serum DNA from patients with non-small cell lung cancer.
22532293 2013 Novel methylation panel for the early detection of neoplasia in high-risk ulcerative colitis and Crohn's colitis patients.
22238370 2012 Global gene analysis of oocytes from early stages in human folliculogenesis shows high expression of novel genes in reproduction.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21559523 2011 TMEFF2 is a PDGF-AA binding protein with methylation-associated gene silencing in multiple cancer types including glioma.
21393249 2011 The tumor suppressor activity of the transmembrane protein with epidermal growth factor and two follistatin motifs 2 (TMEFF2) correlates with its ability to modulate sarcosine levels.
20975101 2010 Three epigenetic biomarkers, GDF15, TMEFF2, and VIM, accurately predict bladder cancer from DNA-based analyses of urine samples.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19288010 2009 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19040536 2008 Aberrant promoter methylation of the TPEF gene in esophageal squamous cell carcinoma.
18799374 2008 Distinct TPEF/HPP1 gene methylation patterns in gastric cancer indicate a field effect in gastric carcinogenesis.
18070176 2008 Methylation of the TPEF- and PAX6-promoters is increased in early bladder cancer and in normal mucosa adjacent to pTa tumours.
18059030 2008 HPP1-mediated tumor suppression requires activation of STAT1 pathways.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17942404 2007 Phorbol ester-induced shedding of the prostate cancer marker transmembrane protein with epidermal growth factor and two follistatin motifs 2 is mediated by the disintegrin and metalloproteinase-17.
17903298 2007 Genome-wide association with diabetes-related traits in the Framingham Heart Study.
17352030 2007 Detection of aberrant methylation in fecal DNA as a molecular screening tool for colorectal cancer and precancerous lesions.
17257419 2007 Novel expressed sequences identified in a model of androgen independent prostate cancer.
16805794 2006 Tomoregulin-2 is found extensively in plaques in Alzheimer's disease brain.
16619216 2006 Hypermethylation of hMLH1, HPP1, p14(ARF), p16(INK4A) and APC in primary adenocarcinomas of the small bowel.
16439095 2006 A truncated isoform of TMEFF2 encodes a secreted protein in prostate cancer cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15824739 2005 Inactivation of p16, RUNX3, and HPP1 occurs early in Barrett's-associated neoplastic progression and predicts progression risk.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15068392 2003 Multigene methylation analysis of gastrointestinal tumors: TPEF emerges as a frequent tumor-specific aberrantly methylated marker that can be detected in peripheral blood.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12729735 2003 Repression of the TMEFF2 promoter by c-Myc.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12460892 2002 Aberrant methylation of the HPP1 gene in ulcerative colitis-associated colorectal carcinoma.
12384516 2002 Hypermethylation of HPP1 is associated with hMLH1 hypermethylation in gastric adenocarcinomas.
11668495 2001 TENB2, a proteoglycan identified in prostate cancer that is associated with disease progression and androgen independence.
11120884 2001 HPP1: a transmembrane protein-encoding gene commonly methylated in colorectal polyps and cancers.
10987305 2000 The gene for a novel transmembrane protein containing epidermal growth factor and follistatin domains is frequently hypermethylated in human tumor cells.
10903839 2000 Identification and characterization of TMEFF2, a novel survival factor for hippocampal and mesencephalic neurons.
10600548 1999 A novel epidermal growth factor-like molecule containing two follistatin modules stimulates tyrosine phosphorylation of erbB-4 in MKN28 gastric cancer cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2408044 1990 Clonal lymphoid progenitor cell lines expressing the BCR/ABL oncogene retain full differentiative function.