Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.14
PubTator Score 14.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.020 7.3e-03
Astrocytoma, Pilocytic 1.100 1.2e-06
ependymoma 1.100 7.4e-09
glioblastoma 1.100 1.6e-05
Multiple myeloma 1.331 6.7e-04
osteosarcoma 1.800 7.6e-04
ovarian cancer -1.100 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.088 3.9e-03
pediatric high grade glioma 1.100 5.0e-05

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGH      1 - 70
YDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENR     71 - 140
VSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKS    141 - 210
FFSDKRTTTTRVGS                                                            211 - 224
//

Text Mined References (16)

PMID Year Title