Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q8WW62 Q6UXN5
Symbols p24g5
PRO34237
SPLL9146

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
26045774 TMED6-COG8 chimera might act as a novel diagnostic marker in TFE3 translocation renal cell carcinoma.

AA Sequence

MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSY      1 - 70
EVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFY     71 - 140
EGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSL    141 - 210
VIILSGILQLYFLKRLFNVPTTTDTKKPRC                                            211 - 240
//

Text Mined References (4)

PMID Year Title
26045774 2015 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.