Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

AA Sequence

MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSY      1 - 70
EVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFY     71 - 140
EGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSL    141 - 210
VIILSGILQLYFLKRLFNVPTTTDTKKPRC                                            211 - 240
//

Text Mined References (4)

PMID Year Title