Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.67
PubTator Score 6.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.037 3.2e-02
Astrocytoma, Pilocytic 1.100 1.7e-06
atypical teratoid / rhabdoid tumor 1.300 1.9e-03
Down syndrome 1.200 6.7e-04
ependymoma 1.300 1.8e-07
glioblastoma 1.300 2.0e-05
intraductal papillary-mucinous neoplasm ... 1.200 4.3e-02
invasive ductal carcinoma -1.171 1.3e-02
lung cancer -1.100 1.6e-02
malignant mesothelioma -1.200 7.8e-07
medulloblastoma, large-cell 1.300 2.7e-04
Multiple myeloma 1.254 1.6e-03
non-small cell lung cancer -1.249 7.9e-14
ovarian cancer 1.400 8.7e-10
pancreatic ductal adenocarcinoma liver m... -3.455 1.8e-04
pediatric high grade glioma 1.600 5.6e-07
pituitary cancer -1.500 5.1e-05

Gene RIF (2)

AA Sequence

MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGL      1 - 70
DIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWK     71 - 140
KYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVS    141 - 210
AIQVYMLKSLFEDKRKSRT                                                       211 - 229
//

Text Mined References (16)

PMID Year Title