Property Summary

NCBI Gene PubMed Count 12
PubMed Score 56.89
PubTator Score 1.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -2.350 5.9e-08
ependymoma 1.100 1.2e-05
atypical teratoid / rhabdoid tumor 1.800 9.5e-06
glioblastoma 1.700 2.7e-04
medulloblastoma 1.100 4.6e-04
medulloblastoma, large-cell 1.500 4.6e-04
primitive neuroectodermal tumor 1.100 2.7e-04
adrenocortical carcinoma -1.150 9.6e-04
tuberculosis 1.100 8.3e-05
intraductal papillary-mucinous adenoma (... -1.300 3.1e-04
intraductal papillary-mucinous carcinoma... -1.600 5.1e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-03
adult high grade glioma 1.600 2.2e-04
lung carcinoma 1.100 1.6e-28
ovarian cancer -2.200 9.0e-07

 GO Function (1)

Pathway (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with transmembrane emp24 protein transport domain containing 4 (TMED4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18326488 ERS25 may play a critical role in regulation of heat-shock response and apoptosis

AA Sequence

MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLP      1 - 70
STPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEH     71 - 140
ANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTG    141 - 210
IWQMRHLKSFFEAKKLV                                                         211 - 227
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18326488 2008 Novel oxidative stress-responsive gene ERS25 functions as a regulator of the heat-shock and cell death response.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.