Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.73
PubTator Score 2176.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer -1.100 3.4e-02
pancreatic cancer -1.400 1.3e-02
Multiple myeloma 1.297 3.9e-04
osteosarcoma 4.732 1.7e-07
posterior fossa group B ependymoma 1.500 1.7e-05
group 4 medulloblastoma 1.800 3.9e-03
glioblastoma 1.300 1.5e-02
medulloblastoma, large-cell 1.800 6.2e-04
acute quadriplegic myopathy 1.039 5.8e-05
pancreatic ductal adenocarcinoma liver m... -2.670 8.0e-04
non-small cell lung cancer 1.055 1.7e-08
breast carcinoma 1.300 2.0e-03
Breast cancer 4.300 2.2e-02
atypical teratoid/rhabdoid tumor 1.100 2.1e-02
non primary Sjogren syndrome sicca 1.400 1.2e-02
pancreatic carcinoma -1.400 1.3e-02
lung adenocarcinoma 2.600 5.4e-07
invasive ductal carcinoma 1.100 1.6e-02
dermatomyositis -1.700 2.5e-03
head and neck cancer 1.300 1.1e-02

Gene RIF (5)

PMID Text
22212250 TMED2/p24beta1 is expressed in all gestational stages of human placentas and in choriocarcinoma cell lines.
21219331 Both p24A transmembrane protein and p23 are specific cargo receptors of G protein-coupled receptors (GPCR) and differentially regulate GPCR signaling in astrocytes.
20361938 These results suggest that p24A is the limiting factor in CaSR trafficking in the early secretory pathway, and that cycling between the ER and ERGIC protects CaSR from degradation.
18187620 Knockdown of transmembrane emp24 domain trafficking protein 2 (TMED2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17693410 p24A is a regulator of signal-dependent trafficking that controls ARF1-dependent resensitization of PAR-2

AA Sequence

MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY      1 - 70
KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVA     71 - 140
MTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV             141 - 201
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22212250 2012 TMED2/p24?1 is expressed in all gestational stages of human placentas and in choriocarcinoma cell lines.
21269460 2011 Initial characterization of the human central proteome.
21219331 2011 Proteinase-activated receptors, nucleotide P2Y receptors, and ?-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
20361938 2010 The cargo receptor p24A facilitates calcium sensing receptor maturation and stabilization in the early secretory pathway.
18287528 2008 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17693410 2007 p24A, a type I transmembrane protein, controls ARF1-dependent resensitization of protease-activated receptor-2 by influence on receptor trafficking.
17321752 2007 Mutations in the SPG3A gene encoding the GTPase atlastin interfere with vesicle trafficking in the ER/Golgi interface and Golgi morphogenesis.
16940185 2006 Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.
16641999 2006 TMP21 is a presenilin complex component that modulates gamma-secretase but not epsilon-secretase activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237308 2002 Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway.
11739402 2001 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.
11703931 2001 KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.
10852829 2000 Coupled transport of p24 family members.
10761932 2000 Decoding of sorting signals by coatomer through a GTPase switch in the COPI coat complex.
10359607 1999 Localization and recycling of gp27 (hp24gamma3): complex formation with other p24 family members.
10214941 1999 p24 and p23, the major transmembrane proteins of COPI-coated transport vesicles, form hetero-oligomeric complexes and cycle between the organelles of the early secretory pathway.
9472029 1998 gp25L/emp24/p24 protein family members of the cis-Golgi network bind both COP I and II coatomer.
8703076 1996 Bimodal interaction of coatomer with the p24 family of putative cargo receptors.
8663407 1996 Tmp21 and p24A, two type I proteins enriched in pancreatic microsomal membranes, are members of a protein family involved in vesicular trafficking.