Property Summary

NCBI Gene PubMed Count 37
PubMed Score 31.41
PubTator Score 38.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.079 4.6e-03
osteosarcoma 1.085 5.5e-03
ependymoma 1.400 2.2e-17
glioblastoma 1.600 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.484 2.6e-02
Breast cancer 2.700 4.0e-02
pediatric high grade glioma 1.100 8.2e-06
pilocytic astrocytoma 1.300 1.9e-09
ovarian cancer -2.400 4.4e-10

 GO Function (1)

 GWAS Trait (1)

Gene RIF (17)

PMID Text
26617795 TMP21 modulates cell growth in papillary thyroid cancer cells by inducing autophagy, which may be associated with activation of AMPK/mTOR pathway.
23434013 Study demonstrates that NleF binds to the human Tmp21 protein and subsequently disrupts intracellular protein trafficking.
23166591 Expression of HIV-1 Tat downregulates the abundance of transmembrane emp24-like trafficking protein 10 (TMED10) in the nucleoli of Jurkat T-cells
22299712 This study suggested that The role ofTMP21 in the modulation of gamma-secretase activity and protein trafficking and related to alzheimer disease.
22204304 Data show that the level of p23 expression is critical for neuronal function, and p23 overexpression initiates a cascade in brainstem that leads to severe motor deficits and other neurological problems, culminating in premature death.
22190034 Expression of HIV-1 Tat downregulates the abundance of transmembrane emp24-like trafficking protein 10 (TMED10) in the nucleoli of Jurkat T-cells
21699748 Results suggest that Tmp21 is a novel protein that preferentially binds to Beta(2)-microglobulin-free MHC-I heavy chains.
21454541 p23 acts as an anchoring protein that retains PKCdelta at the perinuclear region, thus limiting the availability of this kinase for activation in response to stimuli.
21219331 Transmembrane protein 23 and p24A differentially control G-protein coupled receptor trafficking and signaling in astrocytes.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20164256 These results demonstrate that p23/Tmp21 acts as an anchor that distinctively modulates compartmentalization of C1 domain-containing proteins, and it plays an essential role in beta2-chimaerin relocalization.
19710022 the TMP21 transmembrane domain promotes its association with the presenilin complex that results in decreased gamma-cleavage activity
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19046380 Taken together, these results indicate that the degradation of TMP21, as with the other presenilin-associated gamma-secretase complex members, is mediated by the ubiquitin-proteasome pathway.
18652896 p23 is widely distributed throughout the frontal cortex, hippocampus and cerebellum of control and Alzheimer disease (AD)brains; steady-state p23 levels are reduced in the brains of individuals with AD.
18405662 TMP21 behaves as a regulator of gamma- but not epsilon-cleavages of beta-amyloid precursor protein generated by presenilin-dependent gamma-secretase complex.
16641999 TMP21, a member of the p24 cargo protein family, is a component of presenilin complexes and differentially regulates gamma-secretase cleavage without affecting epsilon-secretase activity

AA Sequence

MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGL      1 - 70
RSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAK     71 - 140
VEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRR    141 - 210
FFKAKKLIE                                                                 211 - 219
//

Text Mined References (50)

PMID Year Title
26617795 2015 TMP21 modulates cell growth in papillary thyroid cancer cells by inducing autophagy through activation of the AMPK/mTOR pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23434013 2013 The enterohemorrhagic Escherichia coli effector protein NleF binds mammalian Tmp21.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22299712 2012 The role of TMP21 in trafficking and amyloid-? precursor protein (APP) processing in Alzheimer's disease.
22204304 2011 Transgenic neuronal overexpression reveals that stringently regulated p23 expression is critical for coordinated movement in mice.
21699748 2011 Tmp21, a novel MHC-I interacting protein, preferentially binds to ?2-microglobulin-free MHC-I heavy chains.
21545355 2011 Syntaxin 17 cycles between the ER and ERGIC and is required to maintain the architecture of ERGIC and Golgi.
21454541 2011 p23/Tmp21 associates with protein kinase Cdelta (PKCdelta) and modulates its apoptotic function.
21269460 2011 Initial characterization of the human central proteome.
21219331 2011 Proteinase-activated receptors, nucleotide P2Y receptors, and ?-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
20164256 2010 p23/Tmp21 differentially targets the Rac-GAP beta2-chimaerin and protein kinase C via their C1 domains.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19837036 2009 GPI glycan remodeling by PGAP5 regulates transport of GPI-anchored proteins from the ER to the Golgi.
19710022 2009 TMP21 transmembrane domain regulates gamma-secretase cleavage.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19296914 2009 Arf GAP2 is positively regulated by coatomer and cargo.
19046380 2008 TMP21 degradation is mediated by the ubiquitin-proteasome pathway.
18652896 2008 Localization and regional distribution of p23/TMP21 in the brain.
18405662 2008 TMP21 regulates Abeta production but does not affect caspase-3, p53, and neprilysin.
18287528 2008 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17288597 2007 Dual roles of the transmembrane protein p23/TMP21 in the modulation of amyloid precursor protein metabolism.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16940185 2006 Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.
16641999 2006 TMP21 is a presenilin complex component that modulates gamma-secretase but not epsilon-secretase activity.
16595549 2006 Evidence for a role of transmembrane protein p25 in localization of protein tyrosine phosphatase TC48 to the ER.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237308 2002 Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway.
11739402 2001 Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.
11726511 2001 Recruitment to Golgi membranes of ADP-ribosylation factor 1 is mediated by the cytoplasmic domain of p23.
11689559 2002 Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.
11056392 2000 Identification and characterization of novel isoforms of COP I subunits.
10852829 2000 Coupled transport of p24 family members.
10761932 2000 Decoding of sorting signals by coatomer through a GTPase switch in the COPI coat complex.
10376215 1999 A comparative study of rat and human Tmp21 (p23) reveals the pseudogene-like features of human Tmp21-II.
10359607 1999 Localization and recycling of gp27 (hp24gamma3): complex formation with other p24 family members.
10052452 1999 Coupling of coat assembly and vesicle budding to packaging of putative cargo receptors.
9472029 1998 gp25L/emp24/p24 protein family members of the cis-Golgi network bind both COP I and II coatomer.
8663407 1996 Tmp21 and p24A, two type I proteins enriched in pancreatic microsomal membranes, are members of a protein family involved in vesicular trafficking.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7596406 1995 Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease.