Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.08
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.300 9.4e-05
glioblastoma 1.400 3.6e-04
osteosarcoma -1.223 1.8e-04
posterior fossa group A ependymoma 1.100 1.8e-08
subependymal giant cell astrocytoma 1.239 8.2e-03

Gene RIF (1)

AA Sequence

MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAALCGISLSQLFPEPEHSSFCTEFMAGL      1 - 70
VQWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCH     71 - 140
MTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGL    141 - 210
AAPLVAAGAATIIGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHIT    211 - 280
IAVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIV    281 - 350
AALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQE    351 - 420
KDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDR    421 - 490
RVENVDLTSVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVG    491 - 560
QTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPS    561 - 630
TGLD                                                                      631 - 634
//

Text Mined References (6)

PMID Year Title