Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.190 1.4e-02
acute quadriplegic myopathy 1.409 1.6e-03
adrenocortical carcinoma 1.149 7.9e-03
cystic fibrosis 1.275 1.4e-04
glioblastoma 1.200 1.9e-03
group 4 medulloblastoma 1.500 2.0e-02
interstitial cystitis 1.100 1.3e-03
intraductal papillary-mucinous adenoma (... 1.200 4.5e-02
intraductal papillary-mucinous carcinoma... 1.400 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
juvenile dermatomyositis 1.823 3.9e-11
osteosarcoma -1.251 3.7e-02
posterior fossa group A ependymoma 1.100 1.4e-04
sarcoidosis 1.300 2.2e-02
tuberculosis -1.600 3.7e-03
ulcerative colitis -1.600 5.4e-06

Gene RIF (3)

AA Sequence

MPGSDTALTVDRTYSYPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNLNFDVPDGILDFHKVKLTADS      1 - 70
LKQKILKVTEQIKIEQTSRDGNVAEYLKLVNNADKQQAGRIKQVFEKKNQKSAHSIAQLQKKLEQYHRKL     71 - 140
REIEQNGASRSSKDISKDHLKDIHRSLKDAHVKSRTAPHCMESSKSGMPGVSLTPPVFVFNKSREFANLI    141 - 210
RNKFGSADNIAHLKNSLEEFRPEASARAYGGSATIVNKPKYGSDDECSSGTSGSADSNGNQSFGAGGAST    211 - 280
LDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTDLHQHE    281 - 350
TANLKQELASIEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQALQTDTVNAKVLLGRCINVILA    351 - 420
FMTVILVCVSTIAKFVSPMMKSRCHILGTFFAVTLLAIFCKNWDHILCAIERMIIPR                 421 - 477
//

Text Mined References (10)

PMID Year Title