Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.61
PubTator Score 0.93

Knowledge Summary

Patent (468)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Disease Target Count Z-score Confidence
Parkinson's disease 378 0.0 2.4
Disease Target Count Z-score Confidence
Epidermodysplasia verruciformis 21 4.562 2.3
Nonsyndromic deafness 137 3.369 1.7

Expression

AA Sequence

MKTSKASQRYRGIRRNASQCYLYQESLLLSNLDDSFSADETGDSNDPEQIFQNIQFQKDLMANIRCRPWT      1 - 70
MGQKLRALRQAKNIVLKFEGRLTRTRGYQAAGAELWRKFARLACNFVVIFIPWEMRIKKIESHFGSGVAS     71 - 140
YFIFLRWLFGINIVLTIMTGAFIVIPELIAGQPFGSTARKTIPKEQVSSAQDLDTVWSLGGYLQYSVLFY    141 - 210
GYYGRERKIGRAGYRLPLAYFLVGMAVFAYSFIILLKKMAKNSRTSLASASNENYTFCWRVFCAWDYLIG    211 - 280
NPEAAESKTAAIVNSIREAILEEQEKKKSKNLAVTICLRIIANILVLLSLAGSIYLIYFVVDRSQKLEQS    281 - 350
KKELTLWEKNEVSVVVSLVTMIAPSAFDLIAALEMYHPRTTLRFQLARVLVLYLGNLYSLIIALLDKVNS    351 - 420
MSIEEMATKNNTSHWIDSTTFFATRTAPEEEKWSTSRPGMGLRRNNTWALEETSISAYTMPLIKANKTSL    421 - 490
HTQSPQDQCWETYVGQEMLKLSIIDMLFTVASILLIDFFRGLFVRYLSDYWCWDLESKFPEYGEFKIAEN    491 - 560
VLHLVYNQGMIWMGAFFSPCLPAFNVLKLIGLMYLRSWAVLTCNVPHQQVFRASRSNNFYLAMLLFMLFL    561 - 630
CMLPTIFAIVRYKPSLNCGPFSGQEKIYDIVSETIEKDFPVWFGSVVGHISSPVVILPAVLLLFMLIYYL    631 - 700
QSIARSLKLSNHQLKMQIQNARSEDKKKVAQMVEARIQTQEESTKKLPNDSDLTSQLSSAHSGTPQNNGN    701 - 770
VAHFDSGSSKSGRIETVAQSMPQSPRPGDRAPSSPLPGVPKSRLEHETNRYLHGLCASTSDLHRNRSRTP    771 - 840
MTFTTHIEDVHSEPLFRKDFQQINPPHRGPQASTLLAQGPRPHAPRYYVINECDSYKKKHLNVWPERHFK    841 - 910
IDASGDIVELYPRNVRQYASRVPRQPPSPQLSEEEEETPSRDWIKRSLPPRSLIDLRRAPHFYIGERSES    911 - 980
QTRDPEHQGRVHYKSWNEDFEGHLERPAYVPRKPRSRNFQYPQPPLKPRGKPRFEPSLTESDSVSAASSS    981 - 1050
DQQNSSADQYLQVTHSQGRFPRSVGQPSRRKAKSGQELTVDLDDLICSDV                       1051 - 1100
//

Text Mined References (10)

PMID Year Title